Definitions Related words Mentions
We found 3 dictionaries that define the word glucagon-like peptide-2:

General (1 matching dictionary)
  1. Glucagon-like peptide-2: Wikipedia, the Free Encyclopedia

Science (2 matching dictionaries)
  1. glucagon-like peptide-2, Glucagon-like peptide-2: Cytokines & Cells Online Pathfinder Encyclopaedia

Definitions from Wikipedia (Glucagon-like peptide-2)

noun:  a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.


Words similar to glucagon-like peptide-2

Usage examples for glucagon-like peptide-2

Idioms related to glucagon-like peptide-2

Wikipedia articles (New!)

Words that often appear near glucagon-like peptide-2

Rhymes of glucagon-like peptide-2

Invented words related to glucagon-like peptide-2




Home   Reverse Dictionary / Thesaurus   Datamuse   Word games   Spruce   Feedback   Dark mode   Random word   Help


Color thesaurus

Use OneLook to find colors for words and words for colors

See an example

Literary notes

Use OneLook to learn how words are used by great writers

See an example

Word games

Try our innovative vocabulary games

Play Now

Read the latest OneLook newsletter issue: Compound Your Joy